PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0003000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 155aa    MW: 17794.6 Da    PI: 10.7165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0003000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-18148148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++v q+G g+W++I+++ g++R++k+c++rw++yl
  Spipo17G0003000  1 KGAWTPEEDALLQRCVLQYGEGQWHLIPERAGLRRCRKSCRLRWLNYL 48
                     79********************************************97 PP

2Myb_DNA-binding46.77.3e-155498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg++ ++E +l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Spipo17G0003000 54 RGAFQEDEVDLIIRLHRLLGNR-WSLIAGRIP-GRTANDIKNYWNSC 98
                     899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002496.2E-17148IPR001005SANT/Myb domain
SMARTSM007172.6E-12150IPR001005SANT/Myb domain
PROSITE profilePS5129426.101152IPR017930Myb domain
SuperFamilySSF466893.67E-27195IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-23255IPR009057Homeodomain-like
CDDcd001678.84E-11348No hitNo description
SMARTSM007179.6E-1153101IPR001005SANT/Myb domain
PROSITE profilePS5129418.33853103IPR017930Myb domain
PfamPF002496.4E-145498IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-2356102IPR009057Homeodomain-like
CDDcd001675.50E-95996No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
KGAWTPEEDA LLQRCVLQYG EGQWHLIPER AGLRRCRKSC RLRWLNYLKP SIKRGAFQED  60
EVDLIIRLHR LLGNRWSLIA GRIPGRTAND IKNYWNSCLC KKVGAQGKVA RKINKRRTVG  120
LASETYNSCI WGRATLSPRI AHSPEASLGC RHEIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2511057110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062250.13e-57PREDICTED: transcription factor MYB113-like
SwissprotQ9FNV91e-53MY113_ARATH; Transcription factor MYB113
TrEMBLA0A059BTP42e-57A0A059BTP4_EUCGR; Uncharacterized protein
STRINGSolyc10g086260.1.17e-55(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.17e-55myb domain protein 113